MRPS2 Antibody - N-terminal region : Biotin

MRPS2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56812_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MRPS2

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: MATSSAALPRILGAGARAPSRWLGFLGKATPRPARPSRRTLGSATALMIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 28S ribosomal protein S2, mitochondrial

Protein Size: 296

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56812_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56812_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51116
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×