Msn Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Msn is probably involved in connections of major cytoskeletal structures to the plasma membrane.

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: SELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Moesin

Protein Size: 577

Purification: Affinity Purified

• Artikelnummer: AVIARP56189_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56189_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 17698
• Wirt: Rabbit