MTCH2 Antibody - N-terminal region : HRP

MTCH2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55028_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTCH2

Key Reference: Grinberg,M., (2005) Mol. Cell. Biol. 25 (11), 4579-4590

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: TIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mitochondrial carrier homolog 2

Protein Size: 303

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55028_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55028_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23788
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×