MTHFD2L Antibody - middle region : FITC

MTHFD2L Antibody - middle region : FITC
Artikelnummer
AVIARP56162_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTHFD2L

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: TGIQTFGKNVVVAGRSKNVGMPIAMLLHTDGEHERPGGDATVTIAHRYTP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2

Protein Size: 347

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56162_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56162_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 441024
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×