MTMR14 Antibody - middle region : Biotin

MTMR14 Antibody - middle region : Biotin
Artikelnummer
AVIARP57637_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a myotubularin-related protein. The encoded protein is a phosphoinositide phosphatase that specifically dephosphorylates phosphatidylinositol 3,5-biphosphate and phosphatidylinositol 3-phosphate. Mutations in this gene are correlated with autosomal dominant centronuclear myopathy. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 18.


Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MTMR14

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: NFLKHITSEEFSALKTQRRKSLPARDGGFTLEDICMLRRKDRGSTTSLGS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myotubularin-related protein 14

Protein Size: 650

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57637_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57637_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64419
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×