MYD88 Antibody - N-terminal region : Biotin

MYD88 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56352_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways reg

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYD88

Key Reference: Dhiman,N., (2008) Vaccine 26 (14), 1731-1736

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: YLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myeloid differentiation primary response protein MyD88

Protein Size: 296

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56352_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56352_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4615
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×