Nap1l2 Antibody - N-terminal region : FITC

Nap1l2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57573_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Nap1l2 is a acidic protein which may be involved in interactions with other proteins or DNA.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Nap1l2

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: QTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleosome assembly protein 1-like 2

Protein Size: 460

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57573_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57573_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 17954
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×