NAPEPLD Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NAPEPLD is a phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine (Okamoto et al., 2004 [PubMed 14634025]).[supplied by OMIM, Oct 2008]

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human NAPEPLD

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: AFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-acyl-phosphatidylethanolamine-hydrolyzing phospholipase D

Protein Size: 466

Purification: Affinity Purified

• Artikelnummer: AVIARP55928_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55928_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 222236
• Wirt: Rabbit