NARF Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Several proteins have been found to be prenylated and methylated at their carboxyl-terminal ends. Prenylation was initially believed to be important only for membrane attachment. However, another role for prenylation appears to be its importance in protein-protein interactions. The only nuclear proteins known to be prenylated in mammalian cells are prelamin A- and B-type lamins. Prelamin A is farnesylated and carboxymethylated on the cysteine residue of a carboxyl-terminal CaaX motif. This post-translationally modified cysteine residue is removed from prelamin A when it is endoproteolytically processed into mature lamin A. NARF binds to the prenylated prelamin A carboxyl-terminal tail domain. It may be a component of a prelamin A endoprotease complex. NARF is located in the nucleus, where it partially colocalizes with the nuclear lamina. It shares limited sequence similarity with iron-only bacterial hydrogenases.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NARF

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: RGQAQTPDGHADKALLRQMEGIYADIPVRRPESSAHVQELYQEWLEGINS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA FLJ32404 fis, clone SKMUS2000380, highly similar to Homo sapiens nuclear prelamin A recognition factor (NARF), transcript variant 1, mRNA EMBL BAG51834.1

Protein Size: 397

Purification: Affinity Purified

• Artikelnummer: AVIARP54491_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54491_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26502
• Wirt: Rabbit