NASP Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene. The somatic form is expressed in all mitotic cells, is localize

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NASP

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nuclear autoantigenic sperm protein (Histone-binding) EMBL CAI22461.1

Protein Size: 449

Purification: Affinity Purified

• Artikelnummer: AVIARP57746_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57746_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 4678
• Wirt: Rabbit