NCAPH2 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH2

Key Reference: Ono,T., (2003) Cell 115 (1), 109-121

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: EYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Condensin-2 complex subunit H2

Protein Size: 605

Purification: Affinity Purified

Subunit: H2

• Artikelnummer: AVIARP55483_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55483_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 29781
• Wirt: Rabbit