NCAPH2 Antibody - N-terminal region : HRP

NCAPH2 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55484_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 and SMC4, but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II.Condensin complexes I and II play essential roles in mitotic chromosome assembly and segregation. Both condensins contain 2 invariant structural maintenance of chromosome (SMC) subunits, SMC2 (MIM 605576) and SMC4 (MIM 605575), but they contain different sets of non-SMC subunits. NCAPH2 is 1 of 3 non-SMC subunits that define condensin II (Ono et al., 2003 [PubMed 14532007]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH2

Key Reference: Ono,T., (2003) Cell 115 (1), 109-121

Molecular Weight: 68kDa

Peptide Sequence: Synthetic peptide located within the following region: SGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Condensin-2 complex subunit H2

Protein Size: 605

Purification: Affinity Purified

Subunit: H2
Mehr Informationen
Artikelnummer AVIARP55484_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55484_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29781
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×