NDN Antibody - middle region : Biotin

NDN Antibody - middle region : Biotin
Artikelnummer
AVIARP56358_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDN

Key Reference: Zanella,S., (2008) J. Neurosci. 28 (7), 1745-1755

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Necdin

Protein Size: 321

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56358_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56358_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4692
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×