NDOR1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes an NADPH-dependent diflavin reductase that contains both flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD) binding domains. The encoded protein is an enzyme that catalyzes the transfers electrons from NADPH through FAD and FMN cofactors to potential redox partners. Alternative splicing results in multiple transcript variants.

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: PPQGASLFLVSDQTTGRTPMPSPQLLVLFGSQTGTAQDVSERLGREARRR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 412

Purification: Affinity Purified

• Artikelnummer: AVIARP56043_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56043_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 27158
• Wirt: Rabbit