NDUFS1 Antibody - middle region : FITC

NDUFS1 Antibody - middle region : FITC
Artikelnummer
AVIARP56609_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NDUFS1

Molecular Weight: 77kDa

Peptide Sequence: Synthetic peptide located within the following region: TPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

Protein Size: 727

Purification: Affinity Purified

Subunit: mitochondrial
Mehr Informationen
Artikelnummer AVIARP56609_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56609_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4719
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×