Ndufs6 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Ndufs6 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Molecular Weight: 13kDa

Peptide Sequence: Synthetic peptide located within the following region: AARGFGVQVSPSGEKITHTGQVYDEKDYRRVRFVDRQKEVNENFAIDLIA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial

Protein Size: 116

Purification: Affinity Purified

• Artikelnummer: AVIARP56580_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56580_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 407785
• Wirt: Rabbit