NECAB3 Antibody - middle region : FITC

NECAB3 Antibody - middle region : FITC
Artikelnummer
AVIARP57670_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NECAB3

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: ESVEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: N-terminal EF-hand calcium-binding protein 3

Protein Size: 396

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57670_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57670_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 63941
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×