NFATC1 Antibody - N-terminal region : HRP

NFATC1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP59145_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: NFATC1 is a component of the nuclear factor of activated T cells DNA-binding transcription complex. This complex consists of at least two components: a preexisting cytosolic component that translocates to the nucleus upon T cell receptor (TCR) stimulation, and an inducible nuclear component. Proteins belonging to this family of transcription factors play a central role in inducible gene transcription during immune response. The product of this gene is an inducible nuclear component. It functions as a major molecular target for the immunosuppressive drugs such as cyclosporin A. Different isoforms of this protein may regulate inducible expression of different cytokine genes.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NFATC1

Molecular Weight: 38kDa

Peptide Sequence: Synthetic peptide located within the following region: HVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nuclear factor of activated T-cells, cytoplasmic 1

Protein Size: 353

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59145_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59145_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4772
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×