English
NKIRAS1 Antibody - N-terminal region : Biotin
NKIRAS1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55370_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: NKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NKIRAS1
Key Reference: Adams,M.D., (er) Ann. Rheum. Dis. (2008) In press
Molecular Weight: 22kDa
Peptide Sequence: Synthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: NF-kappa-B inhibitor-interacting Ras-like protein 1
Protein Size: 192
Purification: Affinity Purified
Description of Target: NKIRAS1 is an atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. NKIRAS1 may act by blocking phosphorylation of NFKBIB and mediating cytoplasmic retention of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NKIRAS1
Key Reference: Adams,M.D., (er) Ann. Rheum. Dis. (2008) In press
Molecular Weight: 22kDa
Peptide Sequence: Synthetic peptide located within the following region: CETMEDVYMASVETDRGVKEQLHLYDTRGLQEGVELPKHYFSFADGFVLV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: NF-kappa-B inhibitor-interacting Ras-like protein 1
Protein Size: 192
Purification: Affinity Purified
| Artikelnummer | AVIARP55370_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55370_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 28512 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
