NLRP1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the Ced-4 family of apoptosis proteins. Ced-family members contain a caspase recruitment domain (CARD) and are known to be key mediators of programmed cell death. The encoded protein contains a distinct N-terminal pyrin-like

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP1

Key Reference: Fahy,R.J., (2008) Am. J. Respir. Crit. Care Med. 177 (9), 983-988

Molecular Weight: 155kDa

Peptide Sequence: Synthetic peptide located within the following region: DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NACHT, LRR and PYD domains-containing protein 1

Protein Size: 1375

Purification: Affinity Purified

• Artikelnummer: AVIARP54478_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54478_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22861
• Wirt: Rabbit