NLRP5 Antibody - N-terminal region : Biotin

NLRP5 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP59021_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene belongs to the NALP protein family. Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). Expression of this gene is restricted to the oocyte. A mouse gene that encodes a maternal oocyte protein, similar to this encoded protein, is required for normal early embryogenesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP5

Molecular Weight: 134kDa

Peptide Sequence: Synthetic peptide located within the following region: LAWATSISIFENMNLRTLSEKARDDMKRHSPEDPEATMTDQGPSKEKVPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: NACHT, LRR and PYD domains-containing protein 5

Protein Size: 1200

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP59021_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP59021_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 126206
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×