NME4 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm2

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NME4

Key Reference: Martin,J., (2004) Nature 432 (7020), 988-994

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleoside diphosphate kinase, mitochondrial

Protein Size: 187

Purification: Affinity Purified

• Artikelnummer: AVIARP56611_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56611_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4833
• Wirt: Rabbit