NOSIP Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: NOSIP negatively regulates nitric oxide production by inducing NOS1 and NOS3 translocation to actin cytoskeleton and inhibiting their enzymatic activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NOSIP

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: VEKLIRKDMVDPVTGDKLTDRDIIVLQRGGTGFAGSGVKLQAEKSRPVMQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nitric oxide synthase-interacting protein

Protein Size: 301

Purification: Affinity Purified

• Artikelnummer: AVIARP56785_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56785_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51070
• Wirt: Rabbit