NRBP2 Antibody - middle region : HRP

NRBP2 Antibody - middle region : HRP
Artikelnummer
AVIARP58823_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NRBP2

Key Reference: Wan,D., (2004) Proc. Natl. Acad. Sci. U.S.A. 101 (44), 15724-15729

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: VIQMQCNLERSEDKARWHLTLLLVLEDRLHRQLTYDLLPTDSAQDLASEL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Nuclear receptor-binding protein 2

Protein Size: 258

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58823_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58823_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 340371
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×