English
NUP43 Antibody - middle region : Biotin
NUP43 Antibody - middle region : Biotin
Artikelnummer
AVIARP55922_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 BG567254.1 2-11 11-24 CB989591.1 28-41 25-47 AK074311.1 1-23 48-1751 AF514997.1 1-1704 1752-2581 BC047539.1 2681-3510 2582-2745 BC046637.1 2350-2513 2746-2818 BG527619.1 33-105 c 2819-3862 BC046637.1 2587-3630
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUP43
Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
Molecular Weight: 42kDa
Peptide Sequence: Synthetic peptide located within the following region: HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Nucleoporin Nup43
Protein Size: 380
Purification: Affinity Purified
Description of Target: NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.Bidirectional transport of macromolecules between the cytoplasm and nucleus occurs through nuclear pore complexes (NPCs) embedded in the nuclear envelope. NPCs are composed of subcomplexes, and NUP43 is part of one such subcomplex, Nup107-160 (Loiodice et al., 2004 [PubMed 15146057]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-10 BG567254.1 2-11 11-24 CB989591.1 28-41 25-47 AK074311.1 1-23 48-1751 AF514997.1 1-1704 1752-2581 BC047539.1 2681-3510 2582-2745 BC046637.1 2350-2513 2746-2818 BG527619.1 33-105 c 2819-3862 BC046637.1 2587-3630
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NUP43
Key Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
Molecular Weight: 42kDa
Peptide Sequence: Synthetic peptide located within the following region: HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Nucleoporin Nup43
Protein Size: 380
Purification: Affinity Purified
| Artikelnummer | AVIARP55922_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55922_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 348995 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
