OAZ2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Ornithine decarboxylase catalyzes the conversion of ornithine to putrescine in the first and apparently rate-limiting step in polyamine biosynthesis. The ornithine decarboxylase antizymes play a role in the regulation of polyamine synthesis by binding to

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OAZ2

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: PDGLLADGSKEGLLALLEFAEEKMKVNYVFICFRKGREDRAPLLKTFSFL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ornithine decarboxylase antizyme 2

Protein Size: 189

Purification: Affinity Purified

• Artikelnummer: AVIARP56372_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56372_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4947
• Wirt: Rabbit