ODF2L Antibody - N-terminal region : FITC

ODF2L Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56175_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ODF2L

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: KTVALKKASKVYKQRLDHFTGAIEKLTSQIRDQEAKLSETISASNAWKSH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Outer dense fiber protein 2-like

Protein Size: 513

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56175_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56175_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57489
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×