English
OGDHL Antibody - N-terminal region : HRP
OGDHL Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57175_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: The function of OGDHL remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OGDHL
Molecular Weight: 114kDa
Peptide Sequence: Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: 2-oxoglutarate dehydrogenase-like, mitochondrial
Protein Size: 1010
Purification: Affinity Purified
Description of Target: The function of OGDHL remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OGDHL
Molecular Weight: 114kDa
Peptide Sequence: Synthetic peptide located within the following region: VFGWRSRSSGPPATFPSSKGGGGSSYMEEMYFAWLENPQSVHKSWDSFFR
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: 2-oxoglutarate dehydrogenase-like, mitochondrial
Protein Size: 1010
Purification: Affinity Purified
| Artikelnummer | AVIARP57175_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57175_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 55753 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
