OMP Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Results of the mouse kno

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OMP

Key Reference: Behrens,M., (2003) J. Neurochem. 86 (5), 1289-1296

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Olfactory marker protein

Protein Size: 163

Purification: Affinity Purified

• Artikelnummer: AVIARP56668_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56668_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Goat (Caprine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4975
• Wirt: Rabbit