ONECUT2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: ONECUT2 is a member of the transcription factors of the ONECUT class, whose prototype is hepatocyte nuclear factor (HNF)-6. The distribution of OC-2 mRNA in humans is tissue-restricted, the strongest expression being detected in the liver and skin. ONECUT

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ONECUT2

Key Reference: Chamberlain,P.P., (2007) J. Biol. Chem. 282 (38), 28117-28125

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: One cut domain family member 2

Protein Size: 504

Purification: Affinity Purified

• Artikelnummer: AVIARP57926_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57926_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 9480
• Wirt: Rabbit