ONECUT2 Antibody - middle region : FITC

ONECUT2 Antibody - middle region : FITC
Artikelnummer
AVIARP57926_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ONECUT2 is a member of the transcription factors of the ONECUT class, whose prototype is hepatocyte nuclear factor (HNF)-6. The distribution of OC-2 mRNA in humans is tissue-restricted, the strongest expression being detected in the liver and skin. ONECUT

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ONECUT2

Key Reference: Chamberlain,P.P., (2007) J. Biol. Chem. 282 (38), 28117-28125

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LQEPEFQRMSALRLAACKRKEQEPNKDRNNSQKKSRLVFTDLQRRTLFAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: One cut domain family member 2

Protein Size: 504

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57926_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57926_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9480
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×