OPA1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene product is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. It is a component of the mitochondrial network. Mutations in this gene have been associated with optic atrophy type 1, which is a dominantly inherited optic neuropathy resulting in progressive loss of visual acuity, leading in many cases to legal blindness. Multiple transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 102kDa

Peptide Sequence: Synthetic peptide located within the following region: SPEETAFRATDRGSESDKHFRKVSDKEKIDQLQEELLHTQLKYQRILERL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitochondrial dynamin-like 120 kDa protein EMBL ADP90061.1

Protein Size: 924

Purification: Affinity Purified

• Artikelnummer: AVIARP57715_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57715_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4976
• Wirt: Rabbit