ORC6 Antibody - N-terminal region : Biotin

ORC6 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55021_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. ORC6L is a subunit of the ORC complex. It has been shown that this protein and and ORC1L are loosely associated with the core complex consisting of ORC2L, -3L, -4L and -5L. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ORC6

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: KAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Origin recognition complex subunit 6

Protein Size: 252

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55021_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55021_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23594
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×