ORC6 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. ORC6L is a subunit of the ORC complex. It has been shown that this protein and and ORC1L are loosely associated with the core complex consisting of ORC2L, -3L, -4L and -5L. Gene silencing studies with small interfering RNA demonstrated that this protein plays an essential role in coordinating chromosome replication and segregation with cytokinesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ORC6

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: KAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIKLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Origin recognition complex subunit 6

Protein Size: 252

Purification: Affinity Purified

• Artikelnummer: AVIARP55021_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55021_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23594
• Wirt: Rabbit