OSGIN1 Antibody - N-terminal region : HRP

OSGIN1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55853_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: OSGIN1 regulates the differentiation and proliferation of normal cells through the regulation of cell death.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human OSGIN1

Key Reference: Ong,C.K., (2007) Oncogene 26 (8), 1155-1165

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Oxidative stress-induced growth inhibitor 1

Protein Size: 560

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55853_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55853_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29948
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×