OTUD6B Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Deubiquitinating enzymes (DUBs; see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human OTUD6B

Key Reference: Worby,C.A. (2002) Nat. Rev. Mol. Cell Biol. 3 (12), 919-931

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVTRLVNIVTENC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: OTU domain-containing protein 6B

Protein Size: 323

Purification: Affinity Purified

• Artikelnummer: AVIARP56809_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56809_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51633
• Wirt: Rabbit