PANK4 Antibody - middle region : FITC

PANK4 Antibody - middle region : FITC
Artikelnummer
AVIARP57156_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynt

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PANK4

Key Reference: 0

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: LGAIGAFLKGAEQDNPNQYSWGENYAGSSGLMSASPELGPAQRARSGTFD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pantothenate kinase 4

Protein Size: 773

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57156_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57156_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55229
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×