PANK4 Antibody - N-terminal region : Biotin

PANK4 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57155_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynt

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PANK4

Key Reference: 0

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Pantothenate kinase 4

Protein Size: 773

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57155_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57155_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55229
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×