PBLD Antibody - N-terminal region : FITC

PBLD Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56239_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of the PBLD protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PBLD

Key Reference: van (2005) Nat. Genet. 37 (5), 514-519

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: KLPIFIADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phenazine biosynthesis-like domain-containing protein

Protein Size: 280

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56239_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56239_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64081
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×