Pcnp Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: Pcnp may be involved in cell cycle regulation.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: AFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PEST proteolytic signal-containing nuclear protein

Protein Size: 178

Purification: Affinity Purified

• Artikelnummer: AVIARP57392_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57392_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 328694
• Wirt: Rabbit