PCNP Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PCNP may be involved in cell cycle regulation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCNP

Molecular Weight: 19kDa

Peptide Sequence: Synthetic peptide located within the following region: AKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PEST proteolytic signal-containing nuclear protein

Protein Size: 178

Purification: Affinity Purified

• Artikelnummer: AVIARP57393_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57393_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57092
• Wirt: Rabbit