PCOLCE Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PCOLCE

Key Reference: Grgurevic,L., (2007) Int Orthop 31 (6), 743-751

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Procollagen C-endopeptidase enhancer 1

Protein Size: 449

Purification: Affinity Purified

• Artikelnummer: AVIARP56378_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56378_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5118
• Wirt: Rabbit