PDE1C Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Cyclic nucleotide phosphodiesterases (PDEs) catalyze hydrolysis of the cyclic nucleotides cAMP and cGMP to the corresponding nucleoside 5-prime-monophosphates. Mammalian PDEs have been classified into several families based on their biochemical properties

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE1C

Key Reference: Vandeput,F., (2007) J. Biol. Chem. 282 (45), 32749-32757

Molecular Weight: 72kDa

Peptide Sequence: Synthetic peptide located within the following region: IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PDE1C protein EMBL AAH22479.1

Protein Size: 634

Purification: Affinity Purified

• Artikelnummer: AVIARP56615_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56615_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5137
• Wirt: Rabbit