PDLIM3 Antibody - N-terminal region : Biotin

PDLIM3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55067_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: PDLIM3 contains a PDZ domain and a LIM domain, indicating that it may be involved in cytoskeletal assembly. In support of this, PDLIM3 has been shown to bind the spectrin-like repeats of alpha-actinin-2 and to colocalize with alpha-actinin-2 at the Z lines of skeletal muscle.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDLIM3

Key Reference: Arola,A.M., (2007) Mol. Genet. Metab. 90 (4), 435-440

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: PQTVILPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCPGDVILA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: PDZ and LIM domain protein 3

Protein Size: 364

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55067_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55067_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27295
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×