PEPD Antibody - middle region : FITC

PEPD Antibody - middle region : FITC
Artikelnummer
AVIARP56088_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids.Xaa-Pro dipeptidase is a cytosolic dipeptidase that hydrolyzes dipeptides with proline or hydroxyproline at the carboxy terminus (but not Pro-Pro). It is important in collagen metabolism because of the high levels of iminoacids. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-74 DC395475.1 1-74 75-101 DC385464.1 1-27 102-2018 BC015027.1 1-1917

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PEPD

Key Reference: Surazynski,A., (2008) Int. J. Cancer 122 (6), 1435-1440

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Xaa-Pro dipeptidase

Protein Size: 493

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56088_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56088_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5184
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×