PFKFB4 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PFKFB4 synthesis and degradation of fructose 2,6-bisphosphate.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PFKFB4

Key Reference: Bobarykina,A.Y., (2006) Acta Biochim. Pol. 53 (4), 789-799

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4

Protein Size: 469

Purification: Affinity Purified

• Artikelnummer: AVIARP56584_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56584_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 5210
• Wirt: Rabbit