PGBD2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. This gene belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. The exact function of this gene is not known.

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: GTVREYRTERCPLKDPKELKKMKRGSFDYKVDESEEIIVCRWHDSSVVNI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: PiggyBac transposable element-derived protein 2

Protein Size: 341

Purification: Affinity Purified

• Artikelnummer: AVIARP54445_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54445_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 267002
• Wirt: Rabbit