PHGDH Antibody - middle region : Biotin

PHGDH Antibody - middle region : Biotin
Artikelnummer
AVIARP54801_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: 3-Phosphoglycerate dehydrogenase (PHGDH) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.3-Phosphoglycerate dehydrogenase (PHGDH; EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHGDH

Key Reference: Tsang,H.T., (2006) Genomics 88 (3), 333-346

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: D-3-phosphoglycerate dehydrogenase

Protein Size: 533

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54801_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54801_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26227
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×