PHGDH Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: 3-Phosphoglycerate dehydrogenase (PHGDH) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.3-Phosphoglycerate dehydrogenase (PHGDH; EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHGDH

Key Reference: Tsang,H.T., (2006) Genomics 88 (3), 333-346

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: D-3-phosphoglycerate dehydrogenase

Protein Size: 533

Purification: Affinity Purified

• Artikelnummer: AVIARP54801_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54801_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26227
• Wirt: Rabbit