English
PHLDA1 Antibody - middle region : Biotin
PHLDA1 Antibody - middle region : Biotin
Artikelnummer
AVIARP54809_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHLDA1
Key Reference: Nagai,M.A., (2007) Breast Cancer Res. Treat. 106 (1), 49-56
Molecular Weight: 45kDa
Peptide Sequence: Synthetic peptide located within the following region: PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Pleckstrin homology-like domain family A member 1
Protein Size: 401
Purification: Affinity Purified
Description of Target: PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHLDA1
Key Reference: Nagai,M.A., (2007) Breast Cancer Res. Treat. 106 (1), 49-56
Molecular Weight: 45kDa
Peptide Sequence: Synthetic peptide located within the following region: PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Pleckstrin homology-like domain family A member 1
Protein Size: 401
Purification: Affinity Purified
| Artikelnummer | AVIARP54809_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54809_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 22822 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
